PRODUCT CATEGORY

PRODUCT SEARCH

NEWSLETTER

Register now!Newsletter subscription

  • CATALOG PDF Download
  • BROCHURES PDF Download

Transthyretin

Background

Transthyretin (TTR) is a serum and cerebrospinal fluid carrier of the thyroid hormone thyroxine (T4) and retinol-binding protein bound to retinol.

Recombinant Protein / Transthyretin (His-Tag)

Sequence
MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASG KTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA ALLSPYSYSTTAVVTNPKE

Source
E.coli

Form
Lyophilized

Volume
1 mg / tube

Recombinant Protein / Transthyretin (Met)

Sequence
MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVV TNPKE

Source
E.coli

Form
Lyophilized

Volume 
1 mg / tube

Storage Conditions

Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and store reconstituted product frozen at -20°C or lower. Aliquot to avoid cycles of freeze/thaw.

Product List

Product Name Cat# Quantity Price

Transthyretin(His-Tag)

CSR-KN-TOYU-M01 1MG

¥ 25,000
$ 334
€ 250

Transthyretin(Met)

CSR-KN-TOYU-M02 1MG

¥ 25,000
$ 334
€ 250

To be used for research only. DO NOT use for human gene therapy or clinical diagnosis.