PRODUCT CATEGORY

PRODUCT SEARCH

NEWSLETTER

Register now!Newsletter subscription

  • CATALOG PDF Download
  • BROCHURES PDF Download

pJN-FRase

Description

Gene/Insert name NAD(P)H-flavin oxidoreductase of Vibrio fischeri (FRase)
Vector backbone pUC8
Vector type E. coli
Backbone size w/o insert (bp) 2,650
Bacterial resistance Ampicillin
Growth strain JM83
High or low copyHigh copy
Size10ug

Gene coding region (ORF: Clytin II)

Nucleotide sequence

 

ATTCCCGACATCATAAGTTGTGCAGACAAGAATGTCTGTGGATTAAAATTTCACAAGTAAGGTTTATTAT TATGACGCATCCAATTATTCATGATCTTGAAAATCGTTATACATCAAAAAAATATGACCCATCAAAGAAA GTATCTCAAGAAGATTTAGCGGTTTTGCTTGAGGCTCTGCGTTTATCTGCTTCTTCAATTAATTCACAGC CTTGGAAATTCATTGTTATTGAATCCGATGCAGCGAAGCAACGTATGCATGATTCGTTTGCAAATATGCA TCAGTTTAATCAACCTCACATCAAAGCGTGTTCTCATGTGATTTTATTTGCAAATAAGCTTTCGTATACA CGAGATGATTATGATGTGGTTTTATCTAAAGCGGTTGCTGACAAGCGTATTACTGAAGAGCAAAAAGAAG CTGCTTTTGCTTCGTTTAAGTTTGTAGAATTGAACTGTGATGAAAATGGTGAGCATAAAGCATGGACTAA GCCTCAAGCTTATTTAGCTCTTGGTAATGCTCTGCATACATTAGCTAGACTGAACATTGACTCAACAACA ATGGAAGGCATTGATCCTGAATTATTGAGTGAAATTTTTGCTGATGAATTAAAAGGGTATGAATGTCATG TTGCTTTAGCCATTGGTTATCATCATCCAAGCGAAGATTATAATGCCTCTTTGCCTAAGTCTCGTAAGGC ATTTGAAGACGTAATTACCATCCTTTAGATTCTTAATGTTTGAGATGAAGAAAAGCCAGCGATTTAGCTG GCTTTTGTTTGTGCAAAATGTTCCTAATGGCGTATTACTACGGTAGGAAGTCTATTTAAAGTTTCTTTTA CTCTTTGGTAATTATTGTCAATTACGCGGAAATCATTATCTAAGTAGGTCGAC

 

Amino acid sequence

 

MTHPIIHDLENRYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFIVIESDAAKQRMHDSFANMH QFNQPHIKACSHVILFANKLSYTRDDYDVVLSKAVADKRITEEQKEAAFASFKFVELNCDENGEHKAWTK PQAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELKGYECHVALAIGYHHPSEDYNASLPKSRKA FEDVITIL*

Product List

Product Name Cat# Quantity Price

pJN-FRase (Flavin Oxidoreductase)

JNC-P-006 10UG

¥ 50,000
$ 667
€ 500

References
  • Zenno, S, et al.: FRase amino acid seq. & DNA seq.: GenBank Accession No. D17743. J. Bacteriol 1994, 176: 3536-3543.
  • Inouye, S, et al.: FRase expression and purification. FEBS Lett 1994, 347:163-168.

To be used for research only. DO NOT use for human gene therapy or clinical diagnosis.