PRODUCT CATEGORY

PRODUCT SEARCH

NEWSLETTER

Register now!Newsletter subscription

  • CATALOG PDF Download
  • BROCHURES PDF Download

pCL31 (Wild-type Clytin II)

Description

Gene/Insert name Wild-type Clytin II (C. gregaria)
Vector backbone pBluescript SK
Vector type E. coli
Backbone size w/o insert (bp) 2,958
Bacterial resistance Ampicillin
Growth strain JM83
High or low copyHigh copy
Size10ug

Gene coding region (ORF: Clytin II)

Nucleotide sequence

 

GAATTCGCGGCCGCAAATCGTCTTCTTTCCATGTCGGCTTTAGCTGCAAGATCAAGATTGCAACGCACAG CAAATTTTCACACCAGCATACTGTTGGCTACAGATTCAAAATACGCGGTCAAACTCGATCCTGATTTTGC AAATCCAAAATGGATCAACAGACACAAATTTATGTTCAACTTTTTGGACATAAACGGTAATGGGAAAATC ACATTAGATGAAATCGTCTCCAAAGCTTCAGACGACATTTGTGCTAAACTGGATGCAACACCAGAACAGA CCAAACGTCACCAGGATGCTGTTGAAGCGTTTTTCAAGAAAATGGGCATGGATTATGGTAAAGAAGTTGC ATTCCCAGAATTTATTAAGGGATGGGAAGAGTTGGCCGAACACGACTTGGAACTCTGGTCTCAAAACAAA AGTACATTGATCCGTGAATGGGGAGATGCTGTTTTCGACATTTTCGACAAAGACGCAAGTGGCTCAATCA GTTTAGACGAATGGAAGGCTTACGGACGAATCTCTGGAATCTGTCCATCAGACGAAGACGCTGAGAAGAC GTTCAAACATTGTGATTTGGACAACAGTGGCAAACTTGATGTTGATGAGATGACCAGGCAACATTTAGGC TTCTGGTACACATTGGATCCAACTTCTGATGGTCTTTATGGCAATTTTGTTCCCTAAGAAGCGTTCAATT AAAAACGCTAAACATTGTTCAGTTGTAAAATTATATTCATTTTCATTCCATTTCATAAAATTAGTATTTA TAAATTTGTATCATAAATTGTATCCATGTTGTAAACTAAATAAGGCGGCCGCGAATTC

 

Amino acid sequence

 

EFAAANRLLSMSALAARSRLQRTANFHTSILLATDSKYAVKLDPDFANPKWINRHKFMFNFLDINGNGKI TLDEIVSKASDDICAKLDATPEQTKRHQDAVEAFFKKMGMDYGKEVAFPEFIKGWEELAEHDLELWSQNK STLIREWGDAVFDIFDKDASGSISLDEWKAYGRISGICPSDEDAEKTFKHCDLDNSGKLDVDEMTRQHLG FWYTLDPTSDGLYGNFVP*

Product List

Product Name Cat# Quantity Price

pCL31 (Wild-type Clytin II)

JNC-P-009 10UG

¥ 50,000
$ 667
€ 500

References
  • Inouye, S, et al.: Clytin II amino acid seq. & cDNA seq.: GenBank Accession No. AB360785. J. Biochem 2008, 143: 711-717.

To be used for research only. DO NOT use for human gene therapy or clinical diagnosis.